| CAMPSQ945 |
| Title : |
Cp-thionin-2 |
| GenInfo Identifier : |
114152286 |
| Source : |
Vigna unguiculata [Cowpea] |
| Taxonomy : |
Plantae |
| UniProt: |
P84920 |
| PubMed : |
16824043 |
| Activity : |
Antibacterial |
| Gram Nature : |
Gram +ve, Gram -ve |
| Target : |
Staphylococcus aureus ATTC 25923 ( MIC = 128 mg/ml) , Escherichia coli ATTC 25922 ( MIC = 64 mg/ml) , Pseudomonas syringae ( MIC = 42 mg/ml) |
| Validated : |
Experimentally validated |
| Comment : |
Inactive against Ralstonia solanacearum, Rhataybacter sp.,Erwinia sp. |
| InterPro : |
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0042742 |
Biological process |
Defense response to bacterium |
IEA |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
46 |
Sequence: |
KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC |