CAMPSQ942
Title : Plectasin
GenInfo Identifier : 74639078
Source : Pseudoplectania nigrella [Ebony cup]
Taxonomy : Fungi
UniProt: Q53I06
PDB: 1ZFU, 3E7R, 3E7U
Structure Database : CAMPST91, CAMPST256, CAMPST257
PubMed : 16222292
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
S.pneumoniae
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR001542 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0020002 Cellular component Host cell plasma membrane IEA
GO:0016020 Cellular component Membrane IEA
GO:0015459 Molecular function Potassium channel regulator activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0020002 Cellular component Host cell plasma membrane IEA
GO:0016020 Cellular component Membrane IEA
GO:0015459 Molecular function Potassium channel regulator activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 40
Sequence:
 GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India