CAMPSQ934
Title : Defensin MGD-1 precursor
GenInfo Identifier : 51317001
Source : Mytilus galloprovincialis [Mediterranean mussel]
Taxonomy : Animalia, Molluscs (Bivalvia)
UniProt: P80571
PDB: 1FJN
Structure Database : CAMPST22
PubMed : 8925841
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Hemolytic Activity :
No hemolytic activity
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR001542 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH35_8 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 38
Sequence:
GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India