CAMPSQ933
Title : Beta-defensin 6
GenInfo Identifier : 71152312
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: Q91VD6
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
E.coli ( MIC = 20 microg/ml )
Validated : Experimentally validated
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
Length : 41
Sequence:
QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India