CAMPSQ926
Title : Antifungal protein S
GenInfo Identifier : 417989
Source : Hordeum vulgare [Barley]
Taxonomy : Plantae
UniProt: P33045
PubMed : 1936240
Activity : Antifungal
Target :
Trichoderma viridae , Candida albicans
Validated : Experimentally validated
InterPro : IPR001938 : Thaumatin.
IPR001938 :
AMP Family : Thaumatin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 37
Sequence:
ATFTVINKCQYTVWAAAVPAGGGQKLDAGQTWSIXXP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India