CAMPSQ921
Title : Floral defensin-like protein 2
GenInfo Identifier : 44887845
Source : Petunia x hybrida [Petunia]
Taxonomy : Plantae
UniProt: Q8H6Q0
PubMed : 12644678
Activity : Antifungal
Target :
F.oxysporum ( 86% inhibition at 10 microg/ml) , B. cinerea ( 41% inhibition at 10 microg/ml )
Validated : Experimentally validated
InterPro : IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0005773 Cellular component Vacuole IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 49
Sequence:
GTCKAECPTWEGICINKAPCVKCCKAQPEKFTDGHCSKILRRCLCTKPC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India