| CAMPSQ917 |
| Title : |
Cysteine-rich antifungal protein 1 |
| GenInfo Identifier : |
1703204 |
| Source : |
Sinapis alba [White mustard] |
| Taxonomy : |
Plantae |
| UniProt: |
P30231 |
| PubMed : |
8422949 |
| Activity : |
Antifungal |
| Target : |
Alternaria brassicola ( MIC = 1.2 microg/ml ) , Botrytis cinerea ( MIC = 1.8 microg/ml ) , Fusarium culmorum ( MIC = 4 microg/ml ) , Fusarium oxysporum f.sp.lycopersici ( MIC = 6 microg/ml ) , Pyricularia oryzae ( MIC = 0.5 microg/ml ) , Verticillium dahliae ( MIC = 1.5 microg/ml ) |
| Validated : |
Experimentally validated |
| InterPro : |
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
51 |
Sequence: |
QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC |