| CAMPSQ915 |
| Title : |
Defensin AMP1 |
| GenInfo Identifier : |
75139850 |
| Source : |
Heuchera sanguinea [Coralbells] |
| Taxonomy : |
Plantae |
| UniProt: |
Q7M1F4, P0C8Y5 |
| PubMed : |
7628617 |
| Activity : |
Antifungal |
| Target : |
Botrytis cinerea ( IC50 = 6 microg/ml) , Cladosporium sphaerospermum ( IC50 = 1 microg/ml) , Fusarium culmorum ( IC50 = 1 microg/ml) , Leptosphaeria maculans ( IC50 = 25 microg/ml) , Penicillium digitatum ( IC50 = 1microg/ml) , Trichoderma viride ( IC50 = 15 microg/ml) , Septoria tritiei ( IC50 = 0.5 microg/ml) , Verticilium albo-atrum ( IC50 = 0.5 microg/ml) , Neurospora crassa ( IC50 = 12 microg/ml) |
| Validated : |
Experimentally validated |
| InterPro : |
IPR008176 : Gamma-thionin.
IPR008176 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
|
| AMP Family : |
Defensin |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
54 |
Sequence: |
DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC |