CAMPSQ91
Title : Brevinin-2GHc precursor
GenInfo Identifier : 122056010
Source : Rana guentheri [Gunther frog]
Taxonomy : Animalia, Amphibia
UniProt: A0AEI6
PubMed : 16979798
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
S. aureus FDA209P ( MIC = 9.8 microg/ml ), B. subtilis ATCC 6633 ( MIC = >64 microg/ml ), E. coli O111 ( MIC = 19.6 microg/ml ), E. coli ATCC 25922 ( MIC = 9.8 microg/ml )
Validated : Experimentally validated
Comment : Inavtive against C.albicans
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR012521 :
IPR004275 : Brevinin.
IPR004275 :
AMP Family : Brevinin
Signature :
ID Type Pattern / HMM
BrevininH31_4 HMM
BrevininH_224 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 31
Sequence:
SIWEGIKNAGKGFLVSILDKVRCKVAGGCNP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India