CAMPSQ900
Title : Holotricin-2
GenInfo Identifier : 2493578
Source : Holotrichia diomphalia [Korean black chafer]
Taxonomy : Animalia, Insects
UniProt: Q25054
PubMed : 8188641
Activity : Antibacterial
Gram Nature : Gram -ve
Validated : Experimentally validated
Pfam : PF06286 : Coleoptericin ( Coleoptericin )
InterPro : IPR009382 : Coleoptericin.
IPR009382 :
AMP Family : Coleoptericin
Signature :
ID Type Pattern / HMM
ColeoptericinH_6 HMM
ColeoptericinP_6 Pattern N-T-x-[AGT]-[DQST]-I-[DEN]-[AIV]-x(3)-[GT]-x-[DNR]-x-[DE]-[FV]-x-[AG]-[GNT]-W-[DGNST]-K-V-[IV]-[DR]-G-P-[GN]-[KR]-[AS]-K-P-[NT]-[FWY]-x-[IV]-x-G-[ST]-[HWY]-R
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 72
Sequence:
SLQPGAPSFPMPGSQLPTSVSGNVEKQGRNTIATIDAQHKTDRYDVRGTWTKVVDGPGRS
KPNFRIGGSYRW

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India