CAMPSQ894
Title : Defensin
GenInfo Identifier : 544149
Source : Drosophila melanogaster [Fruit fly]
Taxonomy : Animalia, Insects
UniProt: P36192
PubMed : 8168509
Activity : Antibacterial
Gram Nature : Gram +ve
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR001542 :
IPR003614 : Scorpion_toxin-like.
IPR003614 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IDA
GO:0019731 Biological process Antibacterial humoral response IEP
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0006959 Biological process Humoral immune response IEP
GO:0045087 Biological process Innate immune response IEA
GO:0009617 Biological process Response to bacterium IDA
Length : 40
Sequence:
ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India