CAMPSQ883
Title : Andropin
GenInfo Identifier : 113829
Source : Drosophila melanogaster [Fruit fly]
Taxonomy : Animalia, Insects
UniProt: P21663
PubMed : 1899226
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli D21 ( MIC = 140 microM) , Enterobacter cloacae b312 ( MIC > 300 microM) , Pseudomonas aeruginosa OT97 ( MIC > 300 microM) , Serratia marcescens Db 11 ( MIC > 127 microM) , Serratia marcescens Db 1140 ( MIC > 127 microM) , Bacillus megatherium Bml1 ( MIC = 11 microM) , Bacillus subtilis Bs11 ( MIC = 17 microM) , Micrococcus luteus MIll ( MIC = 20 microM)
Validated : Experimentally validated
Pfam : PF00272 : Cecropin ( Cecropin family )
InterPro : IPR000875 : Cecropin.
IPR000875 :
AMP Family : Cecropin
Signature :
ID Type Pattern / HMM
CecropinH34_5 HMM
CecropinH_72 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0005615 Cellular component Extracellular space HDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IEA
GO:0006962 Biological process Male-specific antibacterial humoral response IDA
GO:0032504 Biological process Multicellular organism reproduction HEP
GO:0009617 Biological process Response to bacterium TAS
Length : 34
Sequence:
VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India