CAMPSQ880
Title : Tachystatin-A2
GenInfo Identifier : 74849791
Source : Tachypleus tridentatus [Japanese horseshoe crab]
Taxonomy : Animalia
UniProt: Q9U8X3
PDB: 1CIX
Structure Database : CAMPST5
PubMed : 10473569 , 11959852
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
S.aureus ( IC50 = 4.2 microg/ml) , C.albicans ( IC50 = 3.0 microg/ml) , P.pastoris ( IC50 = 0.5 microg/ml), E.coli ( IC50 = 25 microg/ml)
Hemolytic Activity :
No hemolysis of sheep erythrocytes
Validated : Experimentally validated
Pfam : PF11406 : Tachystatin_A ( Antimicrobial peptide tachystatin A )
InterPro : IPR022717 : Antimicrobial_tachystatin_A.
IPR022717 :
IPR009030 : Growth_fac_rcpt_N_dom.
IPR009030 :
AMP Family : Tachystatin
Signature :
ID Type Pattern / HMM
TachystatinH_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0015459 Molecular function Potassium channel regulator activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 44
Sequence:
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India