| CAMPSQ855 |
| Title : |
Myticin-B |
| GenInfo Identifier : |
6647598 |
| Source : |
Mytilus galloprovincialis [Mediterranean mussel] |
| Taxonomy : |
Animalia, Molluscs (Bivalvia) |
| UniProt: |
P82102 |
| PubMed : |
10491159 |
| Activity : |
Antibacterial, Antifungal |
| Gram Nature : |
Gram +ve, Gram -ve |
| Target : |
Micrococcus luteus ( MIC = 1-2 microM) , Bacillus megaterium ( MIC = 1-2 microM) , Staphylococcus aureus ( MIC = >20 microM) , Listeria monocytogenes ( MIC = >20 microM) , Enterococcus viridans ( MIC = 2-4 microM) , Escherichia coli D31 ( MIC = 120 -210 microM) , Salmonella newport ( MIC = 120 -210 microM) , Salmonella typhimurium ( MIC => 20 microM) , Brucella suis ( MIC => 20 microM) , Pseudomonas aeruginosa ( MIC => 20 microM) , Vibrio alginolyticus ( MIC => 20 microM) , Vibrio vulnificus ( MIC => 20 microM) , Vibrio splendidus ( MIC => 20 microM) , Fusarium oxysporum ( MIC = 5-10 microM) , Perkinsus marinus ( MIC => 20 microM) |
| Validated : |
Experimentally validated |
| Pfam : |
PF10690 : Myticin-prepro ( Myticin pre-proprotein from the mussel )
|
| InterPro : |
IPR019631 : Myticin_preproprotein.
IPR019631 :
|
| AMP Family : |
Myticin |
| Signature : |
| ID |
Type |
Pattern / HMM |
|
MyticinH_10 |
HMM |
 |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0042742 |
Biological process |
Defense response to bacterium |
IEA |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
40 |
Sequence: |
HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR |
