CAMPSQ820
Title : Enterocin EJ97
GenInfo Identifier : 21702214
Source : Enterococcus faecalis
Taxonomy : Monera
UniProt: Q8KMU4
PubMed : Reference: Patel S, Stott I P, Bhakoo M, Elliott P (1988) Patenting computer-designed peptides. Journal of Computer-Aided Molecular Design, 12: 543-556.
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
Enterococci, Bacillus, Listeria, Staphylococcus aureus
Validated : Experimentally validated
AMP Family : Bacteriocin
Length : 44
Sequence:
MLAKIKAMIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India