CAMPSQ816
Title : Bacteriocin T8
GenInfo Identifier : 488292376
Source : Enterococcus faecium T8
Taxonomy : Monera
UniProt: Q27HG2
PubMed : Reference: Yamada, S., Komori, T., Imaseki, H (1997) Plant Physiol; 115:314.
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
Enterococcus faecalis MDK1 , Enterococcus faecalis MDK2 , Enterococcus faecalis MDK3 , Enterococcus faecalis MDK4 , Enterococcus faecalis MDK5 , Lactobacillus sakei LMG 13558 , Streptococcus thermophilus LMG 13566 , Enterococcus faecalis BFE 1071 , Propionibacterium sp. LMG 13574
Validated : Experimentally validated
Comment : Inactive against Lactobacillus acidophilus LMG 13550 , Lactobacillus bulgaricus LMG 13551 , Lactobacillus bulgaricus LMG 13552 , Lactobacillus casei LHS3 , Lactobacillus casei LMG 13553 , Lactobacillus curvatus DF38 , Lactobacillus fermentum LMG 13554 , L
Pfam : PF01721 : Bacteriocin_II ( Class II bacteriocin )
InterPro : IPR002633 : Bacteriocin_IIa.
IPR002633 :
IPR023384 : Bacteriocin_IIa_CS.
IPR023384 :
IPR023388 : Bacteriocin_IIa_dom.
IPR023388 :
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM
BacteriocinH35_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 44
Sequence:
ATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India