CAMPSQ8121
Title : Beta-defensin
Source : Luscinia svecica [Bluethroat]
Taxonomy : Animalia, Aves
UniProt: G8ACV6
Activity : Antimicrobial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 40
Sequence:
 GDAHGPDSCTHGGGLCRMGSCVSGEYLAHYCFEPVILCCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India