CAMPSQ7991
Title : Beta-defensin
Source : Myotis lucifugus [Little brown bat]
Taxonomy : Animalia, Mammals
UniProt: G1NZQ6
Activity : Antimicrobial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 76
Sequence:
ARPRKCFGNIAGYCRKKCEVGEIQEQPCLYKKFCCINEAENKKYQREQELLLSLLQSDQK
LDYSVLPTITVLTIQL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India