CAMPSQ7983
Title : Beta-defensin
Source : Macaca fascicularis [Crab-eating macaque]
Taxonomy : Animalia, Mammals
UniProt: G7P4U4
Activity : Antimicrobial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0001530 Molecular function Lipopolysaccharide binding IEA
GO:0061760 Biological process Antifungal innate immune response IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0031665 Biological process Negative regulation of lipopolysaccharide-mediated signaling pathway IEA
GO:0043407 Biological process Negative regulation of MAP kinase activity IEA
GO:0032720 Biological process Negative regulation of tumor necrosis factor production IEA
GO:0050729 Biological process Positive regulation of inflammatory response IEA
Length : 43
Sequence:
DRCTKRYGRCKRDCLESEKQIDICSSARKICCIERLYEEDGMF

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India