CAMPSQ794
Title : Circularin A
GenInfo Identifier : 27261531
Source : Clostridium beijerinckii
Taxonomy : Monera
UniProt: Q8GB47
PubMed : Reference: Bull. Chem. Soc. Jpn., 58, 1469-1472 (1985)
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
C. tyrobutyricum NIZO B570 , C. tyrobutyricum ADRIAT 932 , C. tyrobutyricum NIZO B575 , C. tyrobutyricum CNRZ500 , C. tyrobutyricum NIZO B590 , E. faecalis JH2-2 , E. faecalis OG1X , Lactobacillus alimentarius L4 , Lactobacillus sak ATCC 15521 , Lactobacillus sak IFO12456 , L. lactis IL1403 , L. lactis MG1363
Validated : Experimentally validated
Comment : Inactive against C. beijerinckii ATCC 25752 , Lactobacillus brevis L40 , Lactobacillus buchneri L4 , Lactobacillus casei subsp. casei L37 , Lactobacillus plantarum lacC , Pediococcus pentosaceus FBB61-2 , Pediococcus pentosaceus PPE 1.2
Pfam : PF09221 : Bacteriocin_IId ( Bacteriocin class IId cyclical uberolysin-like )
InterPro : IPR009086 : Bacteriocin_AS48.
IPR009086 :
IPR020038 : Bacteriocin_uberolysin.
IPR020038 :
AMP Family : Bacteriocin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016021 Cellular component Integral component of membrane IEA
Length : 69
Sequence:
VAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIASGGAGTLMTIGWATFKATVQKLAK
QSMARAIAY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India