CAMPSQ7770
Title : Beta-defensin
Source : Papio anubis [Olive baboon]
Taxonomy : Animalia, Mammals
UniProt: A0A096NV16
Activity : Antimicrobial
Validated : Predicted
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0051673 Biological process Membrane disruption in other organism IEA
Length : 103
Sequence:
 YSGEKKCWNRSGHCRKQCKDGEAVKETCKNLRACCVPSNEDHRRLPTTSPTPLSDSTPGI
IDNILTIRFTTDYFEISSKKDMVEESEAEQGTQTSPPNVHHTS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India