CAMPSQ758
Title : Cycloviolin-A
GenInfo Identifier : 76364163
Source : Leonia cymosa [Sacha uba]
Taxonomy : Plantae
UniProt: P84637
PubMed : 10813905
Activity : Antiviral
Target :
HIV
Validated : Experimentally validated
Pfam : PF03784 : Cyclotide ( Cyclotide family )
InterPro : IPR005535 : Cyclotide.
IPR005535 :
IPR012323 : Cyclotide_bracelet_CS.
IPR012323 :
IPR017307 : Cyclotide_subgr.
AMP Family : Cyclotide
Signature :
ID Type Pattern / HMM
CyclotideH31_16 HMM
CyclotideH_67 HMM
CyclotideP31_16 Pattern C-[AEG]-[EG]-[ST]-C-x(2)-[GI]-x(4)-[APST]-x(3)-[CG]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0006952 Biological process Defense response IDA
GO:0050688 Biological process Regulation of defense response to virus IEA
Length : 31
Sequence:
 GVIPCGESCVFIPCISAAIGCSCKNKVCYRN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India