CAMPSQ7562
Title : Myotoxin-A
Source : Crotalus viridis viridis [Prairie rattlesnake]
Taxonomy : Animalia, Reptiles
UniProt: P01476
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00819 : Myotoxins ( Myotoxin )
InterPro : IPR023355 : Myo_neuro_toxin.
IPR023355 :
IPR000881 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0015459 Molecular function Potassium channel regulator activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0044564 Biological process Envenomation resulting in occlusion of the pore of voltage-gated potassium channel in other organism ISS
Length : 42
Sequence:
YKQCHKKGGHCFPKEKICIPPSSDLGKMDCRWKWKCCKKGSG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India