CAMPSQ7561
Title : Midkine
Source : Xenopus tropicalis [Western clawed frog]
Taxonomy : Animalia, Amphibia
UniProt: Q6P8F3
Activity : Antibacterial
Validated : Predicted
Pfam : PF01091 : PTN_MK_C ( PTN/MK heparin-binding protein family, C-terminal domain )
PF05196 : PTN_MK_N ( PTN/MK heparin-binding protein family, N-terminal domain )
InterPro : IPR000762 : Midkine_heparin-bd_GF.
IPR000762 :
IPR020090 : PTN/MK_heparin-bd_GF_C_dom.
IPR020090 :
IPR020091 : PTN/MK_heparin-bd_GF_diS.
IPR020091 :
IPR020089 : PTN/MK_heparin-bd_GF_N_dom.
IPR020089 :
IPR020092 : PTN_MK_heparin-bd_GF_CS.
IPR020092 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0008083 Molecular function Growth factor activity IBA
GO:0043395 Molecular function Heparan sulfate proteoglycan binding ISS
GO:0008201 Molecular function Heparin binding ISS
GO:0030154 Biological process Cell differentiation IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0007399 Biological process Nervous system development ISS
GO:0007528 Biological process Neuromuscular junction development ISS
GO:0051781 Biological process Positive regulation of cell division IEA
GO:0009617 Biological process Response to bacterium ISS
Length : 121
Sequence:
 AKNKKEKGKKGASDCTEWTWGRCIPNSKDCGAGTREGTCKEETRKLKCKIPCNWKKAFGA
DCKYKFENWGECNATTGQKVRSGTLKKALYNADCQQTVEATKPCSLKTKSKSKGKKGKGK
E

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India