CAMPSQ7543
Title : Interferon-induced guanylate-binding protein 2
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: Q9Z0E6
Activity : Antiviral
Validated : Predicted
Pfam : PF02263 : GBP ( Guanylate-binding protein, N-terminal domain )
PF02841 : GBP_C ( Guanylate-binding protein, C-terminal domain )
InterPro : IPR030386 :
IPR003191 :
IPR015894 :
IPR027417 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0015629 Cellular component Actin cytoskeleton ISO
GO:0005737 Cellular component Cytoplasm ISO
GO:0031410 Cellular component Cytoplasmic vesicle IDA
GO:0005829 Cellular component Cytosol ISO
GO:0005794 Cellular component Golgi apparatus ISO
GO:0000139 Cellular component Golgi membrane IEA
GO:0005654 Cellular component Nucleoplasm ISO
GO:0005634 Cellular component Nucleus ISO
GO:0048471 Cellular component Perinuclear region of cytoplasm ISO
GO:0020005 Cellular component Symbiont-containing vacuole membrane IDA
GO:0012506 Cellular component Vesicle membrane ISO
GO:0003779 Molecular function Actin binding ISO
GO:0019955 Molecular function Cytokine binding ISO
GO:0019899 Molecular function Enzyme binding ISO
GO:0019003 Molecular function GDP binding ISO
GO:0005525 Molecular function GTP binding ISO
GO:0003924 Molecular function GTPase activity ISS
GO:0051879 Molecular function Hsp90 protein binding ISO
GO:0042802 Molecular function Identical protein binding ISO
GO:0042803 Molecular function Protein homodimerization activity ISO
GO:0030507 Molecular function Spectrin binding ISO
GO:0044406 Biological process Adhesion of symbiont to host IDA
GO:0035458 Biological process Cellular response to interferon-beta IDA
GO:0071346 Biological process Cellular response to interferon-gamma IDA
GO:0071222 Biological process Cellular response to lipopolysaccharide IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0042832 Biological process Defense response to protozoan IDA
GO:0009617 Biological process Response to bacterium IEP
Length : 589
Sequence:
MASEIHMSEPMCLIENTEAQLVINQEALRILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KRTGFSLGSTVQSHTKGIWMWCVPHPKKAGQTLVLLDTEGLEDVEKGDNQNDCWIFALAV
LLSSTFIYNSIGTINQQAMDQLHYVTELTDLIKSKSSPDQSGVDDSANFVGFFPTFVWTL
RDFSLELEVNGKPVTSDEYLEHSLTLKKGADKKTKSFNEPRLCIRKFFPKRKCFIFDRPA
QRKQLSKLETLREEELCGEFVEQVAEFTSYILSYSSVKTLCGGIIVNGPRLKSLVQTYVG
AISNGSLPCMESAVLTLAQIENSAAVQKAITHYEEQMNQKIQMPTETLQELLDLHRPIES
EAIEVFLKNSFKDVDQKFQTELGNLLVAKRDAFIKKNMDVSSARCSDLLEDIFGPLEEEV
KLGTFSKPGGYYLFLQMRQELEKKYNQAPGKGLQAEAMLKNYFDSKADVVETLLQTDQSL
TEAAKEVEEERTKAEAAEAANRELEKKQKEFELMMQQKEKSYQEHVKKLTEKMKDEQKQL
LAEQENIIAAKLREQEKFLKEGFENESKKLIREIDTLKQNKSSGKCTIL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India