CAMPSQ732
Title : Penaeidin 4
GenInfo Identifier : 157881028
Source : Litopenaeus setiferus [Atlantic white shrimp]
Taxonomy : Animalia, Crustaceans (Malacostraca)
UniProt: Q962A7
PDB: 1XV3
Structure Database : CAMPST84
PubMed : 15699044
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve
Target :
Fusarium oxysporum ( MIC = 0.84-1.26 microM ) , Botrytis cinerea ( MIC = 4.38-6.57 microM ) , Penicillium crustosum ( MIC = 1.26-1.9 microM ) , Aerococcus viridans ( MIC = 1.9-2.92 microM ) , Bacillus megaterium ( MIC > 50 microM )
Validated : Experimentally validated
Pfam : PF05927 : Penaeidin ( Penaeidin )
InterPro : IPR009226 : Penaeidin.
IPR009226 :
AMP Family : Penaeidin
Signature :
ID Type Pattern / HMM
PenaeidinH_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cellular component Cytoplasm IEA
GO:0008061 Molecular function Chitin binding IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005737 Cellular component Cytoplasm IEA
GO:0008061 Molecular function Chitin binding IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of another organism IEA
Length : 47
Sequence:
HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India