CAMPSQ6933
Title : Cathelicidin-like peptide
GenInfo Identifier : 528320159
Source : Lachesis muta rhombeata [Bushmaster]
Taxonomy : Animalia, Reptiles
UniProt: U5KJZ2
Activity : Antimicrobial
Validated : Predicted (Based on signature)
InterPro : IPR001894 : Cathelicidin.
IPR001894 :
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM
CathelicidinH_140 HMM
CathelicidinH30_3 HMM
CathelicidinH34_11 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016020 Cellular component Membrane IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 34
Sequence:
KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTFPF

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India