CAMPSQ692
Title : Human defensin 1
GenInfo Identifier : 4758146
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P59665
PDB: 2KHT, 2PM1, 3GNY, 3H6C, 3HJ2, 3HJD, 3LO1, 3LO2, 3LO4, 3LO6, 3LO9, 3LOE, 3LVX, 4DU0
Structure Database : CAMPST178, CAMPST235, CAMPST261, CAMPST264, CAMPST265, CAMPST266, CAMPST274, CAMPST275, CAMPST276, CAMPST277, CAMPST278, CAMPST279, CAMPST280, CAMPST314
PubMed : 17635867
Activity : Antibacterial
Target :
T. cruzi
Validated : Experimentally validated
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
PF00879 : Defensin_propep ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR016327 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
IPR002366 : Defensin_propep.
IPR002366 :
IPR006081 : Mammalian_defensins.
IPR006081 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinP30_10 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL]
DefensinH32_11 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0035578 Cellular component Azurophil granule lumen TAS
GO:0062023 Cellular component Collagen-containing extracellular matrix HDA
GO:0070062 Cellular component Extracellular exosome HDA
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0005796 Cellular component Golgi lumen TAS
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0071222 Biological process Cellular response to lipopolysaccharide IBA
GO:0006935 Biological process Chemotaxis TAS
GO:0050832 Biological process Defense response to fungus IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0042832 Biological process Defense response to protozoan IMP
GO:0051607 Biological process Defense response to virus IEA
GO:0006955 Biological process Immune response TAS
GO:0002227 Biological process Innate immune response in mucosa IDA
GO:0030520 Biological process Intracellular estrogen receptor signaling pathway IDA
GO:0051873 Biological process Killing by host of symbiont cells IDA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0051673 Biological process Membrane disruption in other organism IBA
GO:0035915 Biological process Pore formation in membrane of other organism IDA
GO:0010818 Biological process T cell chemotaxis IDA
GO:0035578 Cellular component Azurophil granule lumen TAS
GO:0062023 Cellular component Collagen-containing extracellular matrix HDA
GO:0070062 Cellular component Extracellular exosome HDA
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0005796 Cellular component Golgi lumen TAS
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0071222 Biological process Cellular response to lipopolysaccharide IBA
GO:0006935 Biological process Chemotaxis TAS
GO:0050832 Biological process Defense response to fungus IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0042832 Biological process Defense response to protozoan IMP
GO:0051607 Biological process Defense response to virus IEA
GO:0006955 Biological process Immune response TAS
GO:0002227 Biological process Innate immune response in mucosa IDA
GO:0030520 Biological process Intracellular estrogen receptor signaling pathway IDA
GO:0051873 Biological process Killing by host of symbiont cells IDA
GO:0031640 Biological process Killing of cells of another organism IDA
GO:0051673 Biological process Membrane disruption in another organism IBA
GO:0052337 Biological process Modification by host of symbiont membrane IDA
GO:0010818 Biological process T cell chemotaxis IDA
Length : 30
Sequence:
ACYCRIPACIAGERRYGTCIYQGRLWAFCC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India