CAMPSQ6785
Title : Big defensin
GenInfo Identifier : 74842161
Source : Branchiostoma belcheri [Amphioxus]
Taxonomy : Animalia
UniProt: Q86QN6
Activity : Antibacterial, Antifungal
Validated : Predicted (Based on signature)
Pfam : PF14862 : Defensin_big ( Big defensin )
InterPro : IPR028060 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region ISS
GO:0050832 Biological process Defense response to fungus ISS
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 117
Sequence:
MEKKTAYCLLFLVLLVPYTALGAVLKRAPAKKEKRAVPLAVPLVYWGASVSPAVWNWLLV
TFGAAAVAAAAVTVSDNDSHSCANNRGWCRSRCFSHEYIDSWHSDVCGSYDCCRPRY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India