CAMPSQ657
Title : Beta-defensin-3
GenInfo Identifier : 9756284
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P81534
PDB: 1KJ6
Structure Database : CAMPST33
PubMed : 11085990, 35052952
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
[ Refer Pubmed ID 11085990: S. aureus ( MIC = 2.5 microg/ml), Streptococcus pyogenes, P. aeruginosa, E. coli, Candida albicans, Enterococcus faecium ], [ Refer Pubmed ID 35052952: Carbapenem-resistant K. pneumoniae Bacterial isolates CRKP-1 (MIC= 4 mg/l), CRKP-2 (MIC= 4 mg/l), CRKP-3 (MIC= 4 mg/l), CRKP-4 (MIC= 8 mg/l), CRKP-5 (MIC= 4 mg/l), CRKP-6 (MIC= 2 mg/l), CRKP-7 (MIC= 4 mg/l), CRKP-8 (MIC= 4 mg/l), CRKP-9 (MIC= 4 mg/l), CRKP-10 (MIC= 8 mg/l), CRKP-11 (MIC= 8 mg/l), CRKP-12 (MIC= 16 mg/l), CRKP-13 (MIC= 8 mg/l), CRKP-14 (MIC= 8 mg/l), CRKP-15 (MIC= 8 mg/l), CRKP-16 (MIC= 2 mg/l), CRKP-17 (MIC= 4 mg/l), CRKP-18 (MIC= 8 mg/l), CRKP-19 (MIC= 8 mg/l), CRKP-20 (MIC= 8 mg/l), CRKP-21 (MIC= 4 mg/l), CRKP-22 (MIC= 4 mg/l), CRKP-23 (MIC= 4 mg/l), Carbapenem-resistant K. aerogenes Bacterial isolates CRKA-1 (MIC= 2 mg/l), CRKA-2 (MIC= 4 mg/l), CRKA-3 (MIC= 2 mg/l), CRKA-4 (MIC= 4 mg/l), CRKA-5 (MIC= 4 mg/l), CRKA-6 (MIC= 2 mg/l), CRKA-7 (MIC= 2 mg/l), CRKA-8 (MIC= 2 mg/l), CRKA-9 (MIC= 2 mg/l), CRKA-10 (MIC= 4 mg/l), CRKA-11 (MIC= 4 mg/l), CRKA-12 (MIC= 2 mg/l), CRKA-13 (MIC= 4 mg/l), CRKA-14 (MIC= 4 mg/l), CRKA-15 (MIC= 2 mg/l), CRKA-16 (MIC= 4 mg/l), CRKA-17 (MIC= 4 mg/l), Carbapenem-resistant P. aeruginosa Bacterial isolates CRPA-1 (MIC= 4 mg/l), CRPA-2 (MIC= 8 mg/l), CRPA-3 (MIC= 4 mg/l), CRPA-4 (MIC= 4 mg/l), CRPA-5 (MIC= 16 mg/l), CRPA-6 (MIC= 8 mg/l), CRPA-7 (MIC= 4 mg/l), CRPA-8 (MIC= 2 mg/l), CRPA-9 (MIC= 2 mg/l), CRPA-10 (MIC= 4 mg/l), CRPA-11 (MIC= 8 mg/l), CRPA-12 (MIC= 8 mg/l), CRPA-13 (MIC= 16 mg/l), Carbapenem-resistant A. baumannii Bacterial isolates CRAB-1 (MIC= 16 mg/l), CRAB-2 (MIC= 8 mg/l), CRAB-3 (MIC= 8 mg/l), CRAB-4 (MIC= 4 mg/l), CRAB-5 (MIC= 4 mg/l), CRAB-6 (MIC= 4 mg/l), CRAB-7 (MIC= 8 mg/l), CRAB-8 (MIC= 16 mg/l), CRAB-9 (MIC= 4 mg/l) ]
Hemolytic Activity :
No Hemolytic activity
Validated : Experimentally validated
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0005796 Cellular component Golgi lumen TAS
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0042742 Biological process Defense response to bacterium IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0051873 Biological process Killing by host of symbiont cells IDA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0005796 Cellular component Golgi lumen TAS
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0042742 Biological process Defense response to bacterium IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0051873 Biological process Killing by host of symbiont cells IDA
GO:0031640 Biological process Killing of cells of another organism IDA
Length : 45
Sequence:
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India