CAMPSQ6445
Title : Osmotin
GenInfo Identifier : 334350799
Source : Calotropis procera [Roostertree]
Taxonomy : Plantae
UniProt: P86363
PubMed : 21334906
Activity : Antifungal
Target :
F. solani ( IC(50)=67.0 microg/ml ), C. gloeosporioides ( IC(50)=32.1 microg/ml ), a Neurospora isolate ( IC(50)=57.5 microg/ml )
Validated : Experimentally validated
InterPro : IPR001938 : Thaumatin.
IPR001938 :
AMP Family : Thaumatin
Signature :
ID Type Pattern / HMM
ThaumatinH_8 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050832 Biological process Defense response to fungus IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 40
Sequence:
ATFTIRNNCPYTIWAAAVPGGGRRLNSGGTWTINVAPGTA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India