CAMPSQ64
Title : Beta-defensin 8
GenInfo Identifier : 1168634
Source : Bos taurus [Bovine]
Taxonomy : Animalia, Mammals
UniProt: P46166
PubMed : 8454635
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
S. aureus ( MIC = 10-300 microg/ml ), E. coli ( MIC = 10-300 microg/ml )
Validated : Experimentally validated
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinP30_10 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL]
DefensinH30_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0042742 Biological process Defense response to bacterium IBA
Length : 38
Sequence:
VRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPQIKCCR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India