CAMPSQ6393
Title : Pathogenesis-related protein 5
GenInfo Identifier : 15222089
Source : Arabidopsis thaliana [Mouse-ear cress]
Taxonomy : Plantae
UniProt: P28493
PubMed : 1392589
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF00314 : Thaumatin ( Thaumatin family )
InterPro : IPR001938 : Thaumatin.
IPR001938 :
IPR017949 : Thaumatin_CS.
IPR017949 :
AMP Family : Thaumatin
Signature :
ID Type Pattern / HMM
ThaumatinH_8 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0048046 Cellular component Apoplast HDA
GO:0005739 Cellular component Mitochondrion HDA
GO:0000325 Cellular component Plant-type vacuole HDA
GO:0099503 Cellular component Secretory vesicle HDA
GO:0003729 Molecular function MRNA binding IDA
GO:0006952 Biological process Defense response IBA
GO:0031540 Biological process Regulation of anthocyanin biosynthetic process IEP
GO:0046686 Biological process Response to cadmium ion IEP
GO:0010224 Biological process Response to UV-B IGI
GO:0009615 Biological process Response to virus IEP
GO:0009627 Biological process Systemic acquired resistance IEP
Length : 239
Sequence:
 MANISSIHILFLVFITSGIAVMATDFTLRNNCPTTVWAGTLAGQGPKLGDGGFELTPGAS
RQLTAPAGWSGRFWARTGCNFDASGNGRCVTGDCGGLRCNGGGVPPVTLAEFTLVGDGGK
DFYDVSLVDGYNVKLGIRPSGGSGDCKYAGCVSDLNAACPDMLKVMDQNNVVACKSACER
FNTDQYCCRGANDKPETCPPTDYSRIFKNACPDAYSYAYDDETSTFTCTGANYEITFCP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India