CAMPSQ6183
Title : Dermaseptin
GenInfo Identifier : 401022257
Source : Phyllomedusa nordestina [Northeastern Brazilian leaf frog]
Taxonomy : Animalia, Amphibia
UniProt: J7H8J4
PubMed : 23159791
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF12121 : DD_K ( Dermaseptin )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
IPR022731 : Dermaseptin.
IPR022731 :
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM
DermaseptinH_57 HMM
DermaseptinH25_8 HMM
DermaseptinH28_12 HMM
DermaseptinH29_3 HMM
DermaseptinH32_4 HMM
DermaseptinH33_3 HMM
DermaseptinP25_8 Pattern G-[IL]-x-[DS]-x-[IL]-K-[DEN]-[ALV]-[AG]-K-[AET]-A-[AG]-x(2)-A-x(3)-[AV]-x-[DEG]-x-[ALV]
DermaseptinP28_12 Pattern W-x(3,4)-K-x-[IV]-[GL]-x(2)-A-[AG]-x-A-[AV]-[GL]-x(2)-[AV]-x-[DGTV]-x-[ALV]-[GN]-[AEQ]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 73
Sequence:
 MAFLKKSIFLALFLGMVSLSICEEEKRENEGEEEQEDDEQSEMKRGLWSTIKNVGKEAAI
AAGKAALGALGEQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India