CAMPSQ6115
Title : Cyclotide chassatide C7
GenInfo Identifier : 384007302
Source : Chassalia chartacea
Taxonomy : Plantae
UniProt: I0B6F4
PubMed : 22467870
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF03784 : Cyclotide ( Cyclotide family )
InterPro : IPR005535 : Cyclotide.
IPR005535 :
IPR012323 : Cyclotide_bracelet_CS.
IPR012323 :
AMP Family : Cyclotide
Signature :
ID Type Pattern / HMM
CyclotideH_67 HMM
CyclotideH28_4 HMM
CyclotideH29_16 HMM
CyclotideH30_27 HMM
CyclotideH31_16 HMM
CyclotideP28_4 Pattern C-G-E-[ST]-C-x(2)-[GIL]-[GP]-C-x-[ST]-[AGPV]-x(3)-C-[QST]-x(4)-[FV]
CyclotideP31_16 Pattern C-[AEG]-[EG]-[ST]-C-x(2)-[GI]-x(4)-[APST]-x(3)-[CG]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 64
Sequence:
VLVASLVMLEAQSSDTIQVPDWGKRLLMNHDSNRVGIPCGESCVWIPCLTAIAGCSCKNK
VCYT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India