CAMPSQ6064
Title : PREDICTED: defensin-5-like
GenInfo Identifier : 297713341
Source : Pongo abelii [Sumatran orangutan]
Taxonomy : Animalia, Mammals
UniProt: H2PRK3
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
PF00879 : Defensin_propep ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR016327 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
IPR002366 : Defensin_propep.
IPR002366 :
IPR006081 : Mammalian_defensins.
IPR006081 :
Signature :
ID Type Pattern / HMM
DefensinH32_11 HMM
Signature :
ID Type Pattern / HMM
CAMPDefH32 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0005796 Cellular component Golgi lumen IEA
GO:0030496 Cellular component Midbody IEA
GO:0042803 Molecular function Protein homodimerization activity IEA
GO:0019730 Biological process Antimicrobial humoral response IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0045087 Biological process Innate immune response IEA
GO:0051873 Biological process Killing by host of symbiont cells IEA
GO:1905710 Biological process Positive regulation of membrane permeability IEA
Length : 94
Sequence:
MRTIAILAAILLVALQAQAESLQERADEAATQKQSGEDNQDLAVSFAGNGLSTLRASDSQ
ARSTCYCRIGLCAAIESYSGRCYISGRRYRLCCR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India