CAMPSQ60
Title : Cecropin-D
GenInfo Identifier : 116092
Source : Hyalophora cecropia [Cecropia moth]
Taxonomy : Animalia, Insects
UniProt: P01510
PubMed : 7140755
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli D21 ( LC = 0.43 microM) , E. coli D31 ( LC = 0.40 microM) , Serratia marcescens Db11 ( LC = 14 microM) , Serratia marcescens Db1108 ( LC = 12 microM) , Serratia marcescens Db1121 ( LC = 12 microM) , Strain 122 ( LC = 19 microM) , P. aeruginosa OT97 ( LC = 100 microM ) , Xenorhabdus nematophilus Xn21 ( LC = 19 microM) , Bacillus megaterium Bmll ( LC = 41 microM) , B. subtilis Bs11 ( LC >95 microM) , B. thuringiensis Bt11 ( LC > 95 microM) , Streptococcus fecalis AD-4 ( LC > 95 microM) , Streptococcus fecalis DS16 ( LC = 88 microM) , Micrococcus luteus M111 ( LC = 21 microM)
Validated : Experimentally validated
Pfam : PF00272 : Cecropin ( Cecropin family )
InterPro : IPR000875 : Cecropin.
IPR000875 :
AMP Family : Cecropin
Signature :
ID Type Pattern / HMM
CecropinH36_4 HMM
CecropinH_72 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0045087 Biological process Innate immune response IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 36
Sequence:
WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India