CAMPSQ5873
Title : Cyclotide cliotide T1 (Fragment)
GenInfo Identifier : 340002876
Source : Clitoria ternatea [Butterfly pea]
Taxonomy : Plantae
UniProt: G1CWH0
PubMed : 21596752
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF16720: Albumin_I_a
PF03784 : Cyclotide ( Cyclotide family )
InterPro : IPR012512 :
IPR005535 : Cyclotide.
IPR005535 :
IPR012323 : Cyclotide_bracelet_CS.
IPR012323 :
AMP Family : Cyclotide
Signature :
ID Type Pattern / HMM
CyclotideH_67 HMM
CyclotideH28_4 HMM
CyclotideH29_16 HMM
CyclotideH30_27 HMM
CyclotideH31_16 HMM
CyclotideP28_4 Pattern C-G-E-[ST]-C-x(2)-[GIL]-[GP]-C-x-[ST]-[AGPV]-x(3)-C-[QST]-x(4)-[FV]
CyclotideP29_16 Pattern C-G-E-[ST]-C-x(2)-[GI]-x-C-x-[STV]-x-[ADGV]-x-[AGST]-C-[ST]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological process Defense response to bacterium IEA
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 94
Sequence:
 IPCGESCVFIPCITGAIGCSCKSKVCYRNHVIAAEAKTMDDHHLLCQSHEDCITKGTGNF
CAPFPDQDIKYGWCFRAESEGFMLKDHLKMSITN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India