CAMPSQ5853
Title : Phylloseptin-s4
GenInfo Identifier : 339272023
Source : Phyllomedusa sauvagei [Sauvage's leaf frog]
Taxonomy : Animalia, Amphibia
UniProt: F7UI87
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
AMP Family : Phylloseptin
Signature :
ID Type Pattern / HMM
PhylloseptinH_19 HMM
PhylloseptinH18_3 HMM
PhylloseptinH19_11 HMM
PhylloseptinH20_5 HMM
PhylloseptinP18_3 Pattern L-[GS]-[LM]-I-P-x-[AI]-[IV]-[ST]-[AG]-[IV]-[AS]-[AS]-[IL]-[AS]-K
PhylloseptinP19_11 Pattern F-[FL]-S-[LM]-[IL]-P-x-[AI]-[AIV]-[GNST]-[AG]-[AIV]-[ASV]-[AS]-[IL]-[AV]-K
PhylloseptinP20_5 Pattern F-[FL]-S-[LM]-[IL]-P-x-[AI]-[AIV]-[GNS]-[AG]-[AIV]-[ASV]-[AST]-[IL]-[AV]-[HK]-x(2)-G
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0016020 Cellular component Membrane IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in other organism IEA
GO:0045087 Biological process Innate immune response IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0016020 Cellular component Membrane IEA
GO:0044218 Cellular component Other organism cell membrane IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in another organism IEA
GO:0045087 Biological process Innate immune response IEA
Length : 66
Sequence:
MAFLKKSLFLVLFLGLVSLSICEEEKRETEEEEHDQEEDDKSEEKRFLSMIPHIVSGVAA
LAKHLG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India