CAMPSQ5835
Title : Nisin U lantibiotic
GenInfo Identifier : 336064391
Source : Streptococcus pasteurianus (strain ATCC 43144 / JCM 5346 / CDC 1723-81)
Taxonomy : Monera
UniProt: F5X6X4
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF02052 : Gallidermin ( Gallidermin )
InterPro : IPR006079 : Lan.
IPR006079 :
Signature :
ID Type Pattern / HMM
BacteriocinH32_6 HMM
Signature :
ID Type Pattern / HMM
CAMPBacH32 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0005102 Molecular function Signaling receptor binding IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0005102 Molecular function Signaling receptor binding IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 55
Sequence:
MNNEDFNLDLVTISKENNSGASPRVTSKSLCTPGCKTGILMTCAIKTATCGCHFG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India