CAMPSQ5816
Title : Esculentin-2ISa protein
GenInfo Identifier : 327133925
Source : Odorrana ishikawae [Ishikawa's frog]
Taxonomy : Animalia, Amphibia
UniProt: F1T151
PubMed : 21193000
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF08023 : Antimicrobial_2 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012521 : Antimicrobial_frog_2.
IPR012521 :
IPR004275 : Brevinin.
IPR004275 :
AMP Family : Esculentin
Signature :
ID Type Pattern / HMM
EsculentinH37_27 HMM
BrevininH22_2 HMM
EsculentinP37_27 Pattern K-x(2)-[AGT]-[KR]-x-G-x(4)-[AGS]-C-K-[AIV]-x(2)-[EQ]-C
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 78
Sequence:
 MFTLKKSLLLLFFLGTISLSVCKQERDADYEDKGEVEEVKRGIFSLIKGAAKLITKTVAK
EAGKTGLELMACKVTNQC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India