CAMPSQ58
Title : Cecropin-B
GenInfo Identifier : 116090
Source : Hyalophora cecropia [Cecropia moth]
Taxonomy : Animalia, Insects
UniProt: P01508
PubMed : 7140755, 28556271, 30823998
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Refer PubMed ID 7140755: E. coli D21 ( LC = 0.32 microM) , E. coli D31 ( LC = 0.32 microM) , Serratia marcescens Db11 ( LC = 4.5 microM) , Serratia marcescens Db1108 ( LC = 2.4 microM) , Serratia marcescens Db1121 ( LC = 2.2 microM) , Serratia marcescens Strain 122 ( LC = 2.9 microM) , P. aeruginosa OT97 ( LC = 1.9 microM ) , Xenorhabdus nematophilus Xn21 ( LC = 1.6 microM) , Bacillus megaterium Bmll ( LC = 0.44 microM) , B. subtilis Bs11 ( LC = 18 microM) , B. thuringiensis Bt11 ( LC > 133 microM) , Streptococcus fecalis AD-4 ( LC = 7.3 microM) , Streptococcus fecalis DS16 ( LC > 24 microM) , Micrococcus luteus M111 ( LC = 1.3 microM); Refer C. albicans (MIC50 = 4microM), C. glabrata (MIC50 = 25microM); Refer PubMed ID 30823998: R. solanacearum (MIC=75 microM)
Validated : Experimentally validated
Pfam : PF00272 : Cecropin ( Cecropin family )
InterPro : IPR000875 : Cecropin.
IPR000875 :
AMP Family : Cecropin
Signature :
ID Type Pattern / HMM
CecropinH35_7 HMM
CecropinH_72 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0045087 Biological process Innate immune response IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 35
Sequence:
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India