CAMPSQ5731
Title : Penaeidin 3
GenInfo Identifier : 307335642
Source : Fenneropenaeus indicus [Indian white prawn]
Taxonomy : Animalia, Crustaceans (Malacostraca)
UniProt: E2IH92
PubMed : 21885268
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF05927 : Penaeidin ( Penaeidin )
InterPro : IPR009226 : Penaeidin.
IPR009226 :
AMP Family : Penaeidin
Signature :
ID Type Pattern / HMM
PenaeidinH_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cellular component Cytoplasm ISS
GO:0008061 Molecular function Chitin binding ISS
GO:0042742 Biological process Defense response to bacterium ISS
GO:0050832 Biological process Defense response to fungus ISS
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0022404 Biological process Molting cycle process IEP
GO:0009617 Biological process Response to bacterium IEP
Length : 80
Sequence:
MRLVVCLVYLVSFALVCQGQGFKGGYTGSYSRAPPYGSRGPISTHPISRPATGCTSCHTI
TFDKAACCRLFGRCCSALKG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India