CAMPSQ5723
Title : Jingdongin-1-MT1 antimicrobial peptide
GenInfo Identifier : 304442886
Source : Amolops mantzorum
Taxonomy : Animalia, Amphibia
UniProt: E1B245
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF08018 : Antimicrobial_1 ( Frog antimicrobial peptide )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR012520 : Antimicrobial_frog_1.
IPR012520 :
IPR004275 : Brevinin.
IPR004275 :
AMP Family : Brevinin
Signature :
ID Type Pattern / HMM
BrevininH_224 HMM
BrevininH17_7 HMM
BrevininH22_2 HMM
BrevininH24_87 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 63
Sequence:
 MFTLKKSLLLLFFLGTINLSLCEQERDADEEERRDDDEMDVEVEKRFLPLFLPKIICAIT
KKC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India