CAMPSQ571
Title : Canine beta-defensin
GenInfo Identifier : 66864905
Source : Canis lupus familiaris [Dog]
Taxonomy : Animalia, Mammals
UniProt: Q863C8
PubMed : 15845463
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
C.albicans 14053 ( MIC = 50 microg/ml ), C.albicans 11006 ( MIC = 5 microg/ml ), E.coli 25922 ( MIC = 20 microg/ml ) , E.coli 700336 ( MIC = 50 microg/ml ) , K.pneumoniae 10031 ( MIC =20 microg/ml ), L.monocytogenes 19115 ( MIC = 10 microg/ml ), S.aureus 10832 ( MIC = 100 microg/ml ), N.gonorrhoeae 10150 ( MIC = 50 microg/ml ), U.canigenitalium 51252 ( MIC = 200 microg/ml ), U.urealyticum 27619 ( MIC = 200 microg/ml )
Validated : Experimentally validated
Pfam : PF13841 : Defensin_beta_2 ( Beta defensin )
InterPro : IPR025933 : Beta_defensin.
IPR025933 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
DefensinH34_9 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 34
Sequence:
KCWNLRGSCREKCIKNEKLYIFCTSGKLCCLKPK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India