CAMPSQ570
Title : Beta-defensin 1
GenInfo Identifier : 3023392
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: P56386
PubMed : 9488417
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli , S. aureus, P. aeruginosa
Validated : Experimentally validated
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
IPR006080 : Defensin_beta/neutrophil.
IPR006080 :
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space ISO
GO:0019898 Cellular component Extrinsic component of membrane ISS
GO:1990742 Cellular component Microvesicle ISS
GO:0097225 Cellular component Sperm midpiece ISS
GO:0031731 Molecular function CCR6 chemokine receptor binding ISS
GO:0042802 Molecular function Identical protein binding ISS
GO:0002526 Biological process Acute inflammatory response IEA
GO:0019731 Biological process Antibacterial humoral response ISO
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide ISO
GO:0035584 Biological process Calcium-mediated signaling using intracellular calcium source ISS
GO:0019933 Biological process CAMP-mediated signaling ISS
GO:0042742 Biological process Defense response to bacterium ISO
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0045087 Biological process Innate immune response IMP
GO:0002227 Biological process Innate immune response in mucosa ISO
GO:0060474 Biological process Positive regulation of flagellated sperm motility involved in capacitation ISS
GO:0009617 Biological process Response to bacterium IMP
GO:0033574 Biological process Response to testosterone IEA
Length : 37
Sequence:
DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India