CAMPSQ5665
Title : Lactotransferrin
GenInfo Identifier : 157819071
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: D3ZAB1
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF00405 : Transferrin ( Transferrin )
InterPro : IPR016357 : Transferrin.
IPR016357 :
IPR001156 : Transferrin_fam.
IPR001156 :
IPR018195 : Transferrin_Fe_BS.
IPR018195 :
Signature :
ID Type Pattern / HMM
TransferrinH_4 HMM
Signature :
ID Type Pattern / HMM
CAMPTraH HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0009986 Cellular component Cell surface ISO
GO:0005737 Cellular component Cytoplasm ISO
GO:0005769 Cellular component Early endosome IBA
GO:0005615 Cellular component Extracellular space ISO
GO:0005886 Cellular component Plasma membrane IBA
GO:0032991 Cellular component Protein-containing complex ISO
GO:0055037 Cellular component Recycling endosome IBA
GO:0030141 Cellular component Secretory granule ISO
GO:0042581 Cellular component Specific granule ISO
GO:0004869 Molecular function Cysteine-type endopeptidase inhibitor activity ISO
GO:0008201 Molecular function Heparin binding ISO
GO:0005506 Molecular function Iron ion binding ISO
GO:0001530 Molecular function Lipopolysaccharide binding ISO
GO:0008233 Molecular function Peptidase activity ISO
GO:0043539 Molecular function Protein serine/threonine kinase activator activity ISO
GO:0019731 Biological process Antibacterial humoral response ISO
GO:0019732 Biological process Antifungal humoral response ISO
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide ISO
GO:0060349 Biological process Bone morphogenesis ISO
GO:0050829 Biological process Defense response to Gram-negative bacterium ISO
GO:0002227 Biological process Innate immune response in mucosa ISO
GO:0006826 Biological process Iron ion transport IBA
GO:0031640 Biological process Killing of cells of other organism ISO
GO:0051673 Biological process Membrane disruption in other organism ISO
GO:0044793 Biological process Negative regulation by host of viral process ISO
GO:0032780 Biological process Negative regulation of ATPase activity ISO
GO:2000117 Biological process Negative regulation of cysteine-type endopeptidase activity ISO
GO:0031665 Biological process Negative regulation of lipopolysaccharide-mediated signaling pathway ISO
GO:1900229 Biological process Negative regulation of single-species biofilm formation in or on host organism ISO
GO:0045071 Biological process Negative regulation of viral genome replication ISO
GO:0048525 Biological process Negative regulation of viral process ISO
GO:1902732 Biological process Positive regulation of chondrocyte proliferation ISO
GO:0043123 Biological process Positive regulation of I-kappaB kinase/NF-kappaB signaling ISO
GO:0051092 Biological process Positive regulation of NF-kappaB transcription factor activity ISO
GO:0045669 Biological process Positive regulation of osteoblast differentiation ISO
GO:0033690 Biological process Positive regulation of osteoblast proliferation ISO
GO:0071902 Biological process Positive regulation of protein serine/threonine kinase activity ISO
GO:0034145 Biological process Positive regulation of toll-like receptor 4 signaling pathway ISO
GO:0001817 Biological process Regulation of cytokine production ISO
GO:0032680 Biological process Regulation of tumor necrosis factor production ISO
Length : 709
Sequence:
MRPFITVLMFLGVLGPFLARIDTVVRWCTISRNEAQKCFMWQEMLNKAGVPKLRCARKYF
MPHCIQEIMMRRADAMTLSGSAIFDFYFPYKLQPIAAEVYGTKEKPRIHYYAVAVVKNSS
DIRLNQLQGLKSCHAGFDTSAGWIAPLGALRPYLNWDEKSVSLEEAVSKFFSQSCVPGIS
KSRFPRLCSLCAGKGEHICDFSPQEPYAGYAGAFRCLRDNAGDVAFIRESTIFEELPNEA
EWDQYKLLCPDNTWKPVTEYKECHLAQIPSRAVVAHVRSEKDSAIWELLHLSQEMFGKNK
TSKFELFGSYLGQKDLLFKDSVIGFVRVPFTVNVWLYLTFSYIMALKSLKESKENVMALR
ARITWCAVGSEEKLKCDQWSRVSVGKITCISCTTTEQCIFSITMGDADAMNLDGGYIYSA
GKCGLVPVLAEIQKSPNSNGSDCVDRPAEGYLAVAAVRKEDTGFTWSTVRGKKSCHTAVD
RTAGWNIPMGLLVNQTNSCQFKEFFNKSCAPGSFLYSNLCALCIGDENGKDKCNPNSQER
YQGYVGAFRCLAEKAGNVAFLKDATVLQNTDGKNADKWAKNLKLDDFELLCLDDTRKPVT
EAKNCHLAVAPNHAVVARKDKARLVQQELLYQQVQFGRNGCRCPEEFCLFRSETKNLLFN
DNTECLAKLPSKITWEEYLGKEYVVAIAHLRQCSNITQEAYNFLALRNS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India