CAMPSQ555
Title : Gallinacin-1
GenInfo Identifier : 6016131, 546442
Source : Gallus gallus [Chicken]
Taxonomy : Animalia, Aves
UniProt: P46156
PubMed : 8150085
Activity : Antibacterial, Antifungal
Target :
E. coli ML-35, L.monocytogenes, C. albicans
Validated : Experimentally validated
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR001855 :
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH34_9 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0030141 Cellular component Secretory granule TAS
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0042056 Molecular function Chemoattractant activity IBA
GO:0060326 Biological process Cell chemotaxis IBA
GO:0006952 Biological process Defense response TAS
GO:0042742 Biological process Defense response to bacterium IBA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 39
Sequence:
GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIW

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India