CAMPSQ5514
Title : Antimicrobial peptide
GenInfo Identifier : 170282827
Source : Limnonectes kuhlii [Kuhl's wart frog]
Taxonomy : Animalia, Amphibia
UniProt: C3RT17
PubMed : 23054029
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
AMP Family : Gaegurin
Signature :
ID Type Pattern / HMM
BrevininH_224 HMM
BrevininH22_2 HMM
BrevininH24_87 HMM
GaegurinP24_7 Pattern A-[AST]-x-[FIV]-L-P-[ST]-[AIV]-[FI]-C-x(4)-K-C
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0031640 Biological process Killing of cells of other organism IDA
Length : 70
Sequence:
MFTMKKSLLFLFFLGTINLSLCEEERNAEEEKRDGDDEMDVEVQKRFIGPVLKMATSILP
TAICKGFKKC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India