CAMPSQ5334
Title : Lactoferrin
GenInfo Identifier : 94574205
Source : Bos taurus [Bovine]
Taxonomy : Animalia, Mammals
UniProt: B9VPZ5
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF00405 : Transferrin ( Transferrin )
InterPro : IPR030684 :
IPR016357 : Transferrin.
IPR016357 :
IPR001156 : Transferrin_fam.
IPR001156 :
IPR018195 : Transferrin_Fe_BS.
IPR018195 :
Signature :
ID Type Pattern / HMM
TransferrinP_4 Pattern W-Q-x(0,1)-R-x(0,1)-M-[KR]-K-[LV]
TransferrinH_4 HMM
Signature :
ID Type Pattern / HMM
CAMPTraP Pattern W-Q-x(0,1)-R-x(0,1)-M-[KR]-K-[LV]
CAMPTraH HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0009986 Cellular component Cell surface IEA
GO:0005615 Cellular component Extracellular space IEA
GO:0032991 Cellular component Protein-containing complex IEA
GO:0042581 Cellular component Specific granule IEA
GO:0004869 Molecular function Cysteine-type endopeptidase inhibitor activity IEA
GO:0008201 Molecular function Heparin binding IEA
GO:0005506 Molecular function Iron ion binding IEA
GO:0001530 Molecular function Lipopolysaccharide binding IEA
GO:0043539 Molecular function Protein serine/threonine kinase activator activity IEA
GO:0004252 Molecular function Serine-type endopeptidase activity IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0019732 Biological process Antifungal humoral response IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IEA
GO:0060349 Biological process Bone morphogenesis IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0002227 Biological process Innate immune response in mucosa IEA
GO:0006811 Biological process Ion transport IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0051673 Biological process Membrane disruption in other organism IEA
GO:0044793 Biological process Negative regulation by host of viral process IEA
GO:0032780 Biological process Negative regulation of ATPase activity IEA
GO:2000117 Biological process Negative regulation of cysteine-type endopeptidase activity IEA
GO:0031665 Biological process Negative regulation of lipopolysaccharide-mediated signaling pathway IEA
GO:1900229 Biological process Negative regulation of single-species biofilm formation in or on host organism IEA
GO:0045071 Biological process Negative regulation of viral genome replication IEA
GO:0001503 Biological process Ossification IEA
GO:1902732 Biological process Positive regulation of chondrocyte proliferation IEA
GO:0043123 Biological process Positive regulation of I-kappaB kinase/NF-kappaB signaling IEA
GO:0051092 Biological process Positive regulation of NF-kappaB transcription factor activity IEA
GO:0045669 Biological process Positive regulation of osteoblast differentiation IEA
GO:0033690 Biological process Positive regulation of osteoblast proliferation IEA
GO:0034145 Biological process Positive regulation of toll-like receptor 4 signaling pathway IEA
GO:0032680 Biological process Regulation of tumor necrosis factor production IEA
Length : 708
Sequence:
MKLFVPALLSLGALGLCLAAPRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAF
ALECIRAIAEKKADAVTLDGGMVFEAGRDPYKLRPVAAEIYGTKESPQTHYYAVAVVKKG
SNFQLDQLQGRKSCHTGLGRSAGWIIPMGILRPYLSWTESLEPLQGAVAKFFSASCVPCI
DRQAYPNLCQLCKGEGENQCACSSREPYFGYSGAFKCLQDGAGDVAFVKETTVFENLPEK
ADRDQYELLCLNNSRAPVDAFKECHLAQVPSHAVVARSVDGKEDLIWKLLSKAQEKFGKN
KSRSFQLFGSPPGQRDLLFKDSALGFLRIPSKVDSALYLGSRYLTTLKNLRETAEEVKAR
YTRVVWCAVGPEEQKKCQQWSQQSGQNVTCATASTTDDCIVLVLKGEADALNLDGGYIYT
AGKCGLVPVLAENRKSSKHSSLDCVLRPTEGYLAVAVVKKANEGLTWNSLKDKKSCHTAV
DRTAGWNIPMGLIVNQTGSCAFDEFFSQSCAPGADPKSRLCALCAGDDQGLDKCVPNSKE
KYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNLNREDFRLLCLDGTRKPV
TEAQSCHLAVAPNHAVVSRSDRAAHVKQVLLHQQALFGKNGKNCPDKFCLFKSETKNLLF
NDNTECLAKLGGRPTYEEYLGTEYVTAIANLKKCSTSPLLEACAFLTR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India